Lineage for d5albl1 (5alb L:4-108)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765054Domain d5albl1: 5alb L:4-108 [270942]
    Other proteins in same PDB: d5albl2
    automated match to d1aqkl1
    complexed with tiq

Details for d5albl1

PDB Entry: 5alb (more details), 2.16 Å

PDB Description: ticagrelor antidote candidate medi2452 in complex with ticagrelor
PDB Compounds: (L:) medi2452 light chain

SCOPe Domain Sequences for d5albl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5albl1 b.1.1.0 (L:4-108) automated matches {Homo sapiens [TaxId: 9606]}
vvtqppsvsaapgqkvtiscsgsnsdignnyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlaitglqagdeadyycgtwlydravglfgggtkvtvlg

SCOPe Domain Coordinates for d5albl1:

Click to download the PDB-style file with coordinates for d5albl1.
(The format of our PDB-style files is described here.)

Timeline for d5albl1: