Lineage for d4y5xk1 (4y5x K:1-97)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2034299Domain d4y5xk1: 4y5x K:1-97 [270902]
    Other proteins in same PDB: d4y5xa_, d4y5xb2, d4y5xc1, d4y5xc2, d4y5xd_, d4y5xe2, d4y5xf1, d4y5xf2, d4y5xg_, d4y5xh2, d4y5xi1, d4y5xi2, d4y5xj_, d4y5xk2, d4y5xl1, d4y5xl2
    automated match to d3t0va_
    complexed with flc, peg

Details for d4y5xk1

PDB Entry: 4y5x (more details), 3.15 Å

PDB Description: diabody 305 complex with epor
PDB Compounds: (K:) diabody 310 VH domain

SCOPe Domain Sequences for d4y5xk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y5xk1 b.1.1.0 (K:1-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
drfsgsksgtsaslaisglqsedeadyycaawddsln

SCOPe Domain Coordinates for d4y5xk1:

Click to download the PDB-style file with coordinates for d4y5xk1.
(The format of our PDB-style files is described here.)

Timeline for d4y5xk1: