Lineage for d4y5xe_ (4y5x E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765185Domain d4y5xe_: 4y5x E: [270901]
    Other proteins in same PDB: d4y5xa_, d4y5xc1, d4y5xc2, d4y5xd_, d4y5xf1, d4y5xf2, d4y5xg_, d4y5xi1, d4y5xi2, d4y5xj_, d4y5xl1, d4y5xl2
    automated match to d3t0va_
    complexed with flc, peg

Details for d4y5xe_

PDB Entry: 4y5x (more details), 3.15 Å

PDB Description: diabody 305 complex with epor
PDB Compounds: (E:) diabody 310 VH domain

SCOPe Domain Sequences for d4y5xe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y5xe_ b.1.1.0 (E:) automated matches {Homo sapiens [TaxId: 9606]}
qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
drfsgsksgtsaslaisglqsedeadyycaawddslndwvfgggtkvtvla

SCOPe Domain Coordinates for d4y5xe_:

Click to download the PDB-style file with coordinates for d4y5xe_.
(The format of our PDB-style files is described here.)

Timeline for d4y5xe_: