Lineage for d4y5xj_ (4y5x J:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758005Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)
  8. 1758296Domain d4y5xj_: 4y5x J: [270892]
    Other proteins in same PDB: d4y5xb_, d4y5xc1, d4y5xc2, d4y5xe_, d4y5xf1, d4y5xf2, d4y5xh_, d4y5xi1, d4y5xi2, d4y5xk_, d4y5xl1, d4y5xl2
    automated match to d4kfzc_
    complexed with flc, peg

Details for d4y5xj_

PDB Entry: 4y5x (more details), 3.15 Å

PDB Description: diabody 305 complex with epor
PDB Compounds: (J:) diabody 310 VL domain

SCOPe Domain Sequences for d4y5xj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y5xj_ b.1.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycvkdrvavagkgsyyfdswgrgttv
tvss

SCOPe Domain Coordinates for d4y5xj_:

Click to download the PDB-style file with coordinates for d4y5xj_.
(The format of our PDB-style files is described here.)

Timeline for d4y5xj_: