SCOPe 2.05: Domain d4y5xf2: 4y5x F:117-222

Lineage for d4y5xf2 (4y5x F:117-222)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (27 PDB entries)

8. Domain d4y5xf2: 4y5x F:117-222 [270881]
   Other proteins in same PDB: d4y5xa_, d4y5xb_, d4y5xd_, d4y5xe_, d4y5xg_, d4y5xh_, d4y5xj_, d4y5xk_
   automated match to d1cn4b2
   complexed with flc, peg

Details for d4y5xf2

PDB Entry: 4y5x, 3.15 Å

PDB Description: diabody 305 complex with epor

PDB Compounds: (F:) erythropoietin receptor

SCOPe Domain Sequences for d4y5xf2:

Sequence; same for both SEQRES and ATOM records:

>d4y5xf2 b.1.2.1 (F:117-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps

Timeline for d4y5xf2:

• d4y5xf2 is new in SCOPe 2.05-stable
  
• d4y5xf2 appears in SCOPe 2.06
  
• d4y5xf2 appears in the current release, SCOPe 2.08