SCOPe 2.08: Domain d4y5xc2: 4y5x C:117-222

Lineage for d4y5xc2 (4y5x C:117-222)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)

8. Domain d4y5xc2: 4y5x C:117-222 [270879]
   Other proteins in same PDB: d4y5xa_, d4y5xb1, d4y5xb2, d4y5xd_, d4y5xe1, d4y5xe2, d4y5xg_, d4y5xh1, d4y5xh2, d4y5xj_, d4y5xk1, d4y5xk2
   automated match to d1cn4b2
   complexed with flc, peg

Details for d4y5xc2

PDB Entry: 4y5x, 3.15 Å

PDB Description: diabody 305 complex with epor

PDB Compounds: (C:) erythropoietin receptor

SCOPe Domain Sequences for d4y5xc2:

Sequence, based on SEQRES records:

>d4y5xc2 b.1.2.1 (C:117-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps

Sequence, based on observed residues (ATOM records):

>d4y5xc2 b.1.2.1 (C:117-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladeshvvlrwlpppetpmtshiryevdvsagqgagsvqrveileg
rtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps

Timeline for d4y5xc2:

• d4y5xc2 first appeared in SCOPe 2.05
  
• d4y5xc2 appears in SCOPe 2.07