SCOPe 2.06: Domain d4y5yf2: 4y5y F:117-224

Lineage for d4y5yf2 (4y5y F:117-224)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries)

8. Domain d4y5yf2: 4y5y F:117-224 [270877]
   Other proteins in same PDB: d4y5ya_, d4y5yb_, d4y5yd_, d4y5ye_
   automated match to d1cn4b2
   complexed with gol

Details for d4y5yf2

PDB Entry: 4y5y, 2.85 Å

PDB Description: diabody 330 complex with epor

PDB Compounds: (F:) erythropoietin receptor

SCOPe Domain Sequences for d4y5yf2:

Sequence, based on SEQRES records:

>d4y5yf2 b.1.2.1 (F:117-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsld

Sequence, based on observed residues (ATOM records):

>d4y5yf2 b.1.2.1 (F:117-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegr
tecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsld

Timeline for d4y5yf2:

• d4y5yf2 first appeared in SCOPe 2.05
  
• d4y5yf2 appears in SCOPe 2.07
  
• d4y5yf2 appears in the current release, SCOPe 2.08