SCOPe 2.05: Domain d4xkfd_: 4xkf D:

Lineage for d4xkfd_ (4xkf D:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (8 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)

8. Domain d4xkfd_: 4xkf D: [270849]
   Other proteins in same PDB: d4xkfa_, d4xkfc_, d4xkfe_
   automated match to d4h32b_
   complexed with gal, nag, sia

Details for d4xkfd_

PDB Entry: 4xkf, 2.45 Å

PDB Description: crystal structure of hemagglutinin from taiwan (2013) h6n1 influenza virus in complex with lsta

PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xkfd_:

Sequence; same for both SEQRES and ATOM records:

>d4xkfd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi

Timeline for d4xkfd_:

• d4xkfd_ is new in SCOPe 2.05-stable
  
• d4xkfd_ appears in SCOPe 2.06
  
• d4xkfd_ appears in the current release, SCOPe 2.08