Lineage for d4x7tl1 (4x7t L:1-110)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765164Domain d4x7tl1: 4x7t L:1-110 [270843]
    Other proteins in same PDB: d4x7tb2, d4x7tl2
    automated match to d1dn0a1
    complexed with so4

Details for d4x7tl1

PDB Entry: 4x7t (more details), 3 Å

PDB Description: structure of omalizumab fab fragment, crystal form 2
PDB Compounds: (L:) Omalizumab-Fab Light chain

SCOPe Domain Sequences for d4x7tl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x7tl1 b.1.1.0 (L:1-110) automated matches {Homo sapiens [TaxId: 9606]}
diqltqspsslsasvgdrvtitcrasqsvdydgdsymnwyqqkpgkapklliyaasyles
gvpsrfsgsgsgtdftltisslqpedfatyycqqshedpytfgqgtkvei

SCOPe Domain Coordinates for d4x7tl1:

Click to download the PDB-style file with coordinates for d4x7tl1.
(The format of our PDB-style files is described here.)

Timeline for d4x7tl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4x7tl2