SCOPe 2.07: Domain d3wsob2: 3wso B:84-162

Lineage for d3wsob2 (3wso B:84-162)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein automated matches [226933] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)

8. Domain d3wsob2: 3wso B:84-162 [270795]
   Other proteins in same PDB: d3wsob1
   automated match to d4i6jc2

Details for d3wsob2

PDB Entry: 3wso, 2.6 Å

PDB Description: crystal structure of the skp1-fbg3 complex

PDB Compounds: (B:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d3wsob2:

Sequence; same for both SEQRES and ATOM records:

>d3wsob2 a.157.1.1 (B:84-162) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikn
dfteeeeaqvrkenqwcee

Timeline for d3wsob2:

• d3wsob2 first appeared in SCOPe 2.05
  
• d3wsob2 appears in SCOPe 2.06
  
• d3wsob2 appears in the current release, SCOPe 2.08