Lineage for d1e0uc1 (1e0u C:70-167)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071820Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2071821Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2071822Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2071823Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2071831Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)
  8. 2071842Domain d1e0uc1: 1e0u C:70-167 [27074]
    Other proteins in same PDB: d1e0ua2, d1e0ua3, d1e0ub2, d1e0ub3, d1e0uc2, d1e0uc3, d1e0ud2, d1e0ud3
    complexed with so4; mutant

Details for d1e0uc1

PDB Entry: 1e0u (more details), 2.8 Å

PDB Description: structure r271l mutant of e. coli pyruvate kinase
PDB Compounds: (C:) pyruvate kinase

SCOPe Domain Sequences for d1e0uc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0uc1 b.58.1.1 (C:70-167) Pyruvate kinase (PK) {Escherichia coli [TaxId: 562]}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

SCOPe Domain Coordinates for d1e0uc1:

Click to download the PDB-style file with coordinates for d1e0uc1.
(The format of our PDB-style files is described here.)

Timeline for d1e0uc1: