Lineage for d1pkyd1 (1pky D:70-167)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804062Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2804063Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2804064Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2804065Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2804073Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)
  8. 2804081Domain d1pkyd1: 1pky D:70-167 [27071]
    Other proteins in same PDB: d1pkya2, d1pkya3, d1pkyb2, d1pkyb3, d1pkyc2, d1pkyc3, d1pkyd2, d1pkyd3

Details for d1pkyd1

PDB Entry: 1pky (more details), 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state
PDB Compounds: (D:) pyruvate kinase

SCOPe Domain Sequences for d1pkyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkyd1 b.58.1.1 (D:70-167) Pyruvate kinase (PK) {Escherichia coli [TaxId: 562]}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

SCOPe Domain Coordinates for d1pkyd1:

Click to download the PDB-style file with coordinates for d1pkyd1.
(The format of our PDB-style files is described here.)

Timeline for d1pkyd1: