Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.0: automated matches [227136] (1 protein) not a true family |
Protein automated matches [226838] (5 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225338] (3 PDB entries) |
Domain d4u39a1: 4u39 A:13-202 [270646] Other proteins in same PDB: d4u39a2, d4u39b2, d4u39c2, d4u39d2, d4u39e2, d4u39f2, d4u39g2, d4u39i2 automated match to d2vxya1 complexed with po4 |
PDB Entry: 4u39 (more details), 3.19 Å
SCOPe Domain Sequences for d4u39a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u39a1 c.32.1.0 (A:13-202) automated matches {Bacillus subtilis [TaxId: 1423]} sikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglgag anpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgvv trpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlrq gvqgisdlia
Timeline for d4u39a1: