Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Escherichia coli [TaxId:562] [49306] (42 PDB entries) Uniprot P00722 |
Domain d4ttgd4: 4ttg D:626-730 [270618] Other proteins in same PDB: d4ttga1, d4ttga3, d4ttga5, d4ttgb1, d4ttgb3, d4ttgb5, d4ttgc1, d4ttgc3, d4ttgc5, d4ttgd1, d4ttgd3, d4ttgd5 automated match to d1jz7a2 complexed with cl, dms, k, mg |
PDB Entry: 4ttg (more details), 1.6 Å
SCOPe Domain Sequences for d4ttgd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttgd4 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d4ttgd4:
View in 3D Domains from same chain: (mouse over for more information) d4ttgd1, d4ttgd2, d4ttgd3, d4ttgd5 |