SCOPe 2.07: Domain d4tvab2: 4tva B:39-151

Lineage for d4tvab2 (4tva B:39-151)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50279] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d4tvab2: 4tva B:39-151 [270610]
   Other proteins in same PDB: d4tvaa_, d4tvab1, d4tvab3, d4tvab4, d4tvab5, d4tvab6
   automated match to d1jjcb3
   protein/RNA complex; complexed with phe, puy

Details for d4tvab2

PDB Entry: 4tva, 2.6 Å

PDB Description: universal pathway for post-transfer editing reactions: insight from crystal structure of tthphers with puromycine

PDB Compounds: (B:) Phenylalanine--tRNA ligase beta subunit

SCOPe Domain Sequences for d4tvab2:

Sequence; same for both SEQRES and ATOM records:

>d4tvab2 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

Timeline for d4tvab2:

• d4tvab2 first appeared in SCOPe 2.05
  
• d4tvab2 appears in SCOPe 2.06
  
• d4tvab2 appears in the current release, SCOPe 2.08