Lineage for d4tvaa_ (4tva A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920795Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 1920796Species Thermus thermophilus [TaxId:274] [55702] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1920805Domain d4tvaa_: 4tva A: [270608]
    Other proteins in same PDB: d4tvab1, d4tvab2, d4tvab3, d4tvab4, d4tvab5, d4tvab6
    automated match to d1eiya2
    protein/RNA complex; complexed with phe, puy

Details for d4tvaa_

PDB Entry: 4tva (more details), 2.6 Å

PDB Description: universal pathway for post-transfer editing reactions: insight from crystal structure of tthphers with puromycine
PDB Compounds: (A:) Phenylalanine--tRNA ligase alpha subunit

SCOPe Domain Sequences for d4tvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tvaa_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d4tvaa_:

Click to download the PDB-style file with coordinates for d4tvaa_.
(The format of our PDB-style files is described here.)

Timeline for d4tvaa_: