Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [270448] (10 PDB entries) |
Domain d4toeo_: 4toe O: [270557] automated match to d3fvba_ complexed with fe2, hem, k, so4 |
PDB Entry: 4toe (more details), 2.2 Å
SCOPe Domain Sequences for d4toeo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4toeo_ a.25.1.0 (O:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} gdkkviqhlnkilgneliainqyflhsrmwnfwglkrlgaheyhesidemkhadklieri lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd ileseeehidyletqlgliqkvglenylqshmhe
Timeline for d4toeo_: