Lineage for d1pklb1 (1pkl B:88-186)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957852Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 957853Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 957854Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 957855Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 957943Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (3 PDB entries)
  8. 957945Domain d1pklb1: 1pkl B:88-186 [27053]
    Other proteins in same PDB: d1pkla2, d1pkla3, d1pklb2, d1pklb3, d1pklc2, d1pklc3, d1pkld2, d1pkld3, d1pkle2, d1pkle3, d1pklf2, d1pklf3, d1pklg2, d1pklg3, d1pklh2, d1pklh3
    complexed with so4

Details for d1pklb1

PDB Entry: 1pkl (more details), 2.35 Å

PDB Description: the structure of leishmania pyruvate kinase
PDB Compounds: (B:) protein (pyruvate kinase)

SCOPe Domain Sequences for d1pklb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pklb1 b.58.1.1 (B:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

SCOPe Domain Coordinates for d1pklb1:

Click to download the PDB-style file with coordinates for d1pklb1.
(The format of our PDB-style files is described here.)

Timeline for d1pklb1: