Lineage for d1pkma1 (1pkm A:116-217)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551526Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 1551527Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 1551528Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 1551529Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 1551535Species Cat (Felis catus) [TaxId:9685] [50804] (1 PDB entry)
  8. 1551536Domain d1pkma1: 1pkm A:116-217 [27051]
    Other proteins in same PDB: d1pkma2, d1pkma3

Details for d1pkma1

PDB Entry: 1pkm (more details), 2.6 Å

PDB Description: the refined three-dimensional structure of cat muscle (m1) pyruvate kinase, at a resolution of 2.6 angstroms
PDB Compounds: (A:) m1 pyruvate kinase

SCOPe Domain Sequences for d1pkma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkma1 b.58.1.1 (A:116-217) Pyruvate kinase (PK) {Cat (Felis catus) [TaxId: 9685]}
peirtglikgsgtaevelkkgatlkitldnaymekcdenvlwldyknickvvevgskvyv
ddglisllvkekgadflvtevenggslgskkgvnlpgaavdl

SCOPe Domain Coordinates for d1pkma1:

Click to download the PDB-style file with coordinates for d1pkma1.
(The format of our PDB-style files is described here.)

Timeline for d1pkma1: