Lineage for d4toar_ (4toa R:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1729986Species Pseudomonas aeruginosa [TaxId:208964] [270448] (9 PDB entries)
  8. 1730028Domain d4toar_: 4toa R: [270493]
    automated match to d3fvba_
    complexed with fe2, hem, k, so4

Details for d4toar_

PDB Entry: 4toa (more details), 1.95 Å

PDB Description: 1.95a resolution structure of iron bound bfrb (n148l) from pseudomonas aeruginosa
PDB Compounds: (R:) bacterioferritin

SCOPe Domain Sequences for d4toar_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4toar_ a.25.1.0 (R:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
dileseeehidyletqlgliqkvglelylqshmhe

SCOPe Domain Coordinates for d4toar_:

Click to download the PDB-style file with coordinates for d4toar_.
(The format of our PDB-style files is described here.)

Timeline for d4toar_: