Lineage for d1aqfe1 (1aqf E:116-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804062Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2804063Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2804064Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2804065Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2804114Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (7 PDB entries)
  8. 2804143Domain d1aqfe1: 1aqf E:116-217 [27047]
    Other proteins in same PDB: d1aqfa2, d1aqfa3, d1aqfb2, d1aqfb3, d1aqfc2, d1aqfc3, d1aqfd2, d1aqfd3, d1aqfe2, d1aqfe3, d1aqff2, d1aqff3, d1aqfg2, d1aqfg3, d1aqfh2, d1aqfh3
    complexed with k, mg, peq
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1aqfe1

PDB Entry: 1aqf (more details), 2.7 Å

PDB Description: pyruvate kinase from rabbit muscle with mg, k, and l-phospholactate
PDB Compounds: (E:) pyruvate kinase

SCOPe Domain Sequences for d1aqfe1:

Sequence, based on SEQRES records: (download)

>d1aqfe1 b.58.1.1 (E:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

Sequence, based on observed residues (ATOM records): (download)

>d1aqfe1 b.58.1.1 (E:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
pepgaavdl

SCOPe Domain Coordinates for d1aqfe1:

Click to download the PDB-style file with coordinates for d1aqfe1.
(The format of our PDB-style files is described here.)

Timeline for d1aqfe1: