Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies) alpha-beta(3)-alpha(2); 2 layers, alpha/beta |
Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) |
Family d.48.1.0: automated matches [227236] (1 protein) not a true family |
Protein automated matches [226990] (3 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [270303] (16 PDB entries) |
Domain d4ppga2: 4ppg A:270-332 [270366] Other proteins in same PDB: d4ppga1 automated match to d2zrma2 complexed with flc |
PDB Entry: 4ppg (more details), 3 Å
SCOPe Domain Sequences for d4ppga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ppga2 d.48.1.0 (A:270-332) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} sregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvadeiekkikeklg iga
Timeline for d4ppga2: