Lineage for d1a49h1 (1a49 H:4916-5017)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62010Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
  4. 62011Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 62012Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 62013Protein Pyruvate kinase (PK) [50802] (5 species)
  7. 62043Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (4 PDB entries)
  8. 62051Domain d1a49h1: 1a49 H:4916-5017 [27033]
    Other proteins in same PDB: d1a49a2, d1a49a3, d1a49b2, d1a49b3, d1a49c2, d1a49c3, d1a49d2, d1a49d3, d1a49e2, d1a49e3, d1a49f2, d1a49f3, d1a49g2, d1a49g3, d1a49h2, d1a49h3

Details for d1a49h1

PDB Entry: 1a49 (more details), 2.1 Å

PDB Description: bis mg-atp-k-oxalate complex of pyruvate kinase

SCOP Domain Sequences for d1a49h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a49h1 b.58.1.1 (H:4916-5017) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus)}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

SCOP Domain Coordinates for d1a49h1:

Click to download the PDB-style file with coordinates for d1a49h1.
(The format of our PDB-style files is described here.)

Timeline for d1a49h1: