Class a: All alpha proteins [46456] (290 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein Cytochrome c peroxidase, CCP [48119] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries) Uniprot P00431 |
Domain d4p4qc_: 4p4q C: [270327] Other proteins in same PDB: d4p4qb_, d4p4qd_ automated match to d2bcna_ complexed with hem |
PDB Entry: 4p4q (more details), 2.01 Å
SCOPe Domain Sequences for d4p4qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p4qc_ a.93.1.1 (C:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt hlknsgyegpfgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
Timeline for d4p4qc_: