Lineage for d4p13b1 (4p13 B:10-241)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246108Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 2246149Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)
  7. 2246150Species Human (Homo sapiens) [TaxId:9606] [56651] (5 PDB entries)
    Uniprot P11310 34-421
  8. 2246152Domain d4p13b1: 4p13 B:10-241 [270323]
    Other proteins in same PDB: d4p13a2, d4p13b2, d4p13c2, d4p13d2
    automated match to d1egda2
    complexed with fad; mutant

Details for d4p13b1

PDB Entry: 4p13 (more details), 1.73 Å

PDB Description: medium chain acyl-coa dehydrogenase, k304e mutant
PDB Compounds: (B:) Medium-chain specific acyl-CoA dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4p13b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p13b1 e.6.1.1 (B:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOPe Domain Coordinates for d4p13b1:

Click to download the PDB-style file with coordinates for d4p13b1.
(The format of our PDB-style files is described here.)

Timeline for d4p13b1: