Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (94 PDB entries) |
Domain d5af4e_: 5af4 E: [270197] automated match to d2murb_ complexed with gol, so4 |
PDB Entry: 5af4 (more details), 1.85 Å
SCOPe Domain Sequences for d5af4e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5af4e_ d.15.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d5af4e_: