Lineage for d5af4f_ (5af4 F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1893246Protein automated matches [190118] (9 species)
    not a true protein
  7. 1893271Species Human (Homo sapiens) [TaxId:9606] [189560] (79 PDB entries)
  8. 1893344Domain d5af4f_: 5af4 F: [270192]
    automated match to d2murb_
    complexed with gol, so4

Details for d5af4f_

PDB Entry: 5af4 (more details), 1.85 Å

PDB Description: structure of lys33-linked diub
PDB Compounds: (F:) Ubiquitin

SCOPe Domain Sequences for d5af4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5af4f_ d.15.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlr

SCOPe Domain Coordinates for d5af4f_:

Click to download the PDB-style file with coordinates for d5af4f_.
(The format of our PDB-style files is described here.)

Timeline for d5af4f_: