Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
Protein automated matches [190563] (18 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187760] (1 PDB entry) |
Domain d4yf2b_: 4yf2 B: [270187] Other proteins in same PDB: d4yf2a2 automated match to d1lsga1 |
PDB Entry: 4yf2 (more details), 2.15 Å
SCOPe Domain Sequences for d4yf2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yf2b_ d.2.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} akvfsrcelakemhdfgldgyrgynladwvclayytsgfntnavdheadgstnngifqis srrwcrtlasngpnlcriyctdllnndlkdsivcamkivqeplglgyweawrhhcqgrdl sdwvdgcdf
Timeline for d4yf2b_: