SCOPe 2.05: Domain d4y0va_: 4y0v A:

Lineage for d4y0va_ (4y0v A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [226210] (4 PDB entries)

8. Domain d4y0va_: 4y0v A: [270171]
   automated match to d2x77b_
   complexed with gdp, mg

Details for d4y0va_

PDB Entry: 4y0v, 1.8 Å

PDB Description: structure of an adp ribosylation factor from entamoeba histolytica hm- 1:imss bound to mg-gdp

PDB Compounds: (A:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d4y0va_:

Sequence, based on SEQRES records:

>d4y0va_ c.37.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
dvggqdkirplwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfan
khdlpqamsisevteklglqtiknrkwycqtscatngdglyegldwladnl

Sequence, based on observed residues (ATOM records):

>d4y0va_ c.37.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
dvgglwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfankhdlpq
amsisevteklglqtiknrkwycqtscatngdglyegldwladnl

Timeline for d4y0va_:

• d4y0va_ is new in SCOPe 2.05-stable
  
• d4y0va_ appears in SCOPe 2.06
  
• d4y0va_ appears in the current release, SCOPe 2.08