Class b: All beta proteins [48724] (177 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (13 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [270125] (2 PDB entries) |
Domain d4xixb_: 4xix B: [270128] automated match to d3mdza_ complexed with 2hp, zn |
PDB Entry: 4xix (more details), 2.7 Å
SCOPe Domain Sequences for d4xixb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xixb_ b.74.1.0 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} awnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvlntg hgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnlavl gimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypgsl ttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
Timeline for d4xixb_: