Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
Protein HSP90 [55876] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [55878] (93 PDB entries) Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223 |
Domain d4xiqa_: 4xiq A: [270123] automated match to d2xjxa_ complexed with 40y, gol |
PDB Entry: 4xiq (more details), 1.84 Å
SCOPe Domain Sequences for d4xiqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xiqa_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt eyleerrikeivkkhsqfigypitlfvek
Timeline for d4xiqa_: