Class b: All beta proteins [48724] (141 folds) |
Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily) barrel, closed; n=6, S=12; mixed beta-sheet |
Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family) dimer of non-identical beta-sheet domains |
Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins) heterodimer of two homologous chains |
Protein Small chain TOA2, C-terminal domain [88686] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88687] (2 PDB entries) |
Domain d1ytfd2: 1ytf D:55-119 [27011] Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfb_, d1ytfc_, d1ytfd1 protein/DNA complex |
PDB Entry: 1ytf (more details), 2.5 Å
SCOP Domain Sequences for d1ytfd2:
Sequence, based on SEQRES records: (download)
>d1ytfd2 b.56.1.1 (D:55-119) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} ntqskltvkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklriv acnsk
>d1ytfd2 b.56.1.1 (D:55-119) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} ntqskltvkgnldtygfcddvwtfivkncqvtvesvisvdklrivacnsk
Timeline for d1ytfd2:
View in 3D Domains from other chains: (mouse over for more information) d1ytfa1, d1ytfa2, d1ytfb_, d1ytfc_ |