Lineage for d1ytfd2 (1ytf D:55-119)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300760Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
    barrel, closed; n=6, S=12; mixed beta-sheet
  4. 300761Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family) (S)
    dimer of non-identical beta-sheet domains
  5. 300762Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins)
    heterodimer of two homologous chains
  6. 300766Protein Small chain TOA2, C-terminal domain [88686] (1 species)
  7. 300767Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88687] (1 PDB entry)
  8. 300768Domain d1ytfd2: 1ytf D:55-119 [27011]
    Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfb_, d1ytfc_, d1ytfd1
    protein/DNA complex

Details for d1ytfd2

PDB Entry: 1ytf (more details), 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

SCOP Domain Sequences for d1ytfd2:

Sequence, based on SEQRES records: (download)

>d1ytfd2 b.56.1.1 (D:55-119) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ntqskltvkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklriv
acnsk

Sequence, based on observed residues (ATOM records): (download)

>d1ytfd2 b.56.1.1 (D:55-119) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ntqskltvkgnldtygfcddvwtfivkncqvtvesvisvdklrivacnsk

SCOP Domain Coordinates for d1ytfd2:

Click to download the PDB-style file with coordinates for d1ytfd2.
(The format of our PDB-style files is described here.)

Timeline for d1ytfd2: