Lineage for d1ytfc1 (1ytf C:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169709Fold b.56: Transcription factor IIA (TFIIA), N-terminal domain [50783] (1 superfamily)
  4. 169710Superfamily b.56.1: Transcription factor IIA (TFIIA), N-terminal domain [50784] (1 family) (S)
  5. 169711Family b.56.1.1: Transcription factor IIA (TFIIA), N-terminal domain [50785] (1 protein)
  6. 169712Protein Transcription factor IIA (TFIIA), N-terminal domain [50786] (1 species)
  7. 169713Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50787] (1 PDB entry)
  8. 169714Domain d1ytfc1: 1ytf C: [27010]
    Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfb1, d1ytfd1

Details for d1ytfc1

PDB Entry: 1ytf (more details), 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

SCOP Domain Sequences for d1ytfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytfc1 b.56.1.1 (C:) Transcription factor IIA (TFIIA), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
enlmlclydkvtrtkarwkcslkdgvvtinrndytfqkaqveaewv

SCOP Domain Coordinates for d1ytfc1:

Click to download the PDB-style file with coordinates for d1ytfc1.
(The format of our PDB-style files is described here.)

Timeline for d1ytfc1: