Lineage for d1gg3c2 (1gg3 C:188-279)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551215Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 1551216Protein Erythroid membrane protein 4.1R [50781] (1 species)
  7. 1551217Species Human (Homo sapiens) [TaxId:9606] [50782] (1 PDB entry)
  8. 1551220Domain d1gg3c2: 1gg3 C:188-279 [27009]
    Other proteins in same PDB: d1gg3a1, d1gg3a3, d1gg3b1, d1gg3b3, d1gg3c1, d1gg3c3

Details for d1gg3c2

PDB Entry: 1gg3 (more details), 2.8 Å

PDB Description: crystal structure of the protein 4.1r membrane binding domain
PDB Compounds: (C:) erythroid membrane protein 4.1r

SCOPe Domain Sequences for d1gg3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gg3c2 b.55.1.5 (C:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]}
gvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffikirpgeq
eqyestigfklpsyraakklwkvcvehhtffr

SCOPe Domain Coordinates for d1gg3c2:

Click to download the PDB-style file with coordinates for d1gg3c2.
(The format of our PDB-style files is described here.)

Timeline for d1gg3c2: