SCOP 1.59: Domain d1gg3c2: 1gg3 C:188-279

Lineage for d1gg3c2 (1gg3 C:188-279)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)

4. Superfamily b.55.1: PH domain-like [50729] (5 families)

5. Family b.55.1.5: Third domain of FERM [50776] (4 proteins)

6. Protein Erythroid membrane protein 4.1R [50781] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50782] (1 PDB entry)

8. Domain d1gg3c2: 1gg3 C:188-279 [27009]
   Other proteins in same PDB: d1gg3a1, d1gg3a3, d1gg3b1, d1gg3b3, d1gg3c1, d1gg3c3

Details for d1gg3c2

PDB Entry: 1gg3, 2.8 Å

PDB Description: crystal structure of the protein 4.1r membrane binding domain

SCOP Domain Sequences for d1gg3c2:

Sequence; same for both SEQRES and ATOM records:

>d1gg3c2 b.55.1.5 (C:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens)}
gvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffikirpgeq
eqyestigfklpsyraakklwkvcvehhtffr

Timeline for d1gg3c2:

• d1gg3c2 first appeared (with stable ids) in SCOP 1.55
  
• d1gg3c2 appears in SCOP 1.57
  
• d1gg3c2 appears in SCOP 1.61
  
• d1gg3c2 appears in the current release, SCOPe 2.08