SCOPe 2.08: Domain d4wxgc_: 4wxg C:

Lineage for d4wxgc_ (4wxg C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein automated matches [190152] (25 species)
   not a true protein

7. Species Streptococcus thermophilus [TaxId:299768] [270038] (8 PDB entries)

8. Domain d4wxgc_: 4wxg C: [270040]
   automated match to d1dfoa_
   complexed with 2bo, gol, na

Details for d4wxgc_

PDB Entry: 4wxg, 2 Å

PDB Description: crystal structure of l-serine hydroxymethyltransferase in complex with a mixture of l-threonine and glycine

PDB Compounds: (C:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4wxgc_:

Sequence; same for both SEQRES and ATOM records:

>d4wxgc_ c.67.1.4 (C:) automated matches {Streptococcus thermophilus [TaxId: 299768]}
dykafdpelwnaidaeaerqqnnieliasenvvskavmaaqgtlltnkyaegypgkryyg
gtavidvvetlaierakklfgakfanvqphsgsqanaavymsliqpgdtvmgmdlsaggh
lthgapvsfsgktynfvsynvdkeselldydailaqakevrpklivagasaysriidfak
freiadavgaylmvdmahiaglvasghhpspvpyahvttttthktlrgprggliltdded
iakklnsavfpglqggplehviaakavalkealdpafkeygenviknaaamadvfnqhpd
frvisggtnnhlflvdvtkvvengkvaqnvleevnitlnknsipyeqlspfktsgirvgs
paitsrgmgeaesrqiaewmvealenhdkpevlerirgdvkvltdafply

Timeline for d4wxgc_:

• d4wxgc_ first appeared in SCOPe 2.05
  
• d4wxgc_ appears in SCOPe 2.07