Lineage for d3ws1a_ (3ws1 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244171Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2244172Species Chromohalobacter sp. [TaxId:169132] [270012] (7 PDB entries)
  8. 2244173Domain d3ws1a_: 3ws1 A: [270036]
    automated match to d1s6ra_
    complexed with ca, cs; mutant

Details for d3ws1a_

PDB Entry: 3ws1 (more details), 1.8 Å

PDB Description: n288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1b)
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3ws1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ws1a_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Chromohalobacter sp. [TaxId: 169132]}
qtrevldpivaslmeaqqipgmaialvrpegttishygaadretgtpvdddtlfeigsls
ktltatlaslaevegkldfdapvsrylpelegsafddisglnlgthtggglplfvpdevt
draslmawyrewqptepigesrtysnlgigllgletaasldgefvptmrakvlaplgmqd
twydvpearmadyamgedkdgqptrvspgvlddeaygikttaadlaklvranlhladvda
elqqaidatrqghyrvgdmtqaliweqyslpvapetlragqgydmilepnaaealeppqs
prddvwvnktgstqgfggyivmlpgkhtglvmlanknypndarveaayrilsglgaidvp

SCOPe Domain Coordinates for d3ws1a_:

Click to download the PDB-style file with coordinates for d3ws1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ws1a_: