Lineage for d3ws0b_ (3ws0 B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2618365Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2618366Species Chromohalobacter sp. [TaxId:169132] [270012] (7 PDB entries)
  8. 2618377Domain d3ws0b_: 3ws0 B: [270034]
    automated match to d1s6ra_
    complexed with ca, cl, cs; mutant

Details for d3ws0b_

PDB Entry: 3ws0 (more details), 2 Å

PDB Description: n288q-n321q mutant beta-lactamase derived from chromohalobacter sp.560 (condition-1a)
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3ws0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ws0b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Chromohalobacter sp. [TaxId: 169132]}
rqtrevldpivaslmeaqqipgmaialvrpegttishygaadretgtpvdddtlfeigsl
sktltatlaslaevegkldfdapvsrylpelegsafddisglnlgthtggglplfvpdev
tdraslmawyrewqptepigesrtysnlgigllgletaasldgefvptmrakvlaplgmq
dtwydvpearmadyamgedkdgqptrvspgvlddeaygikttaadlaklvranlhladvd
aelqqaidatrqghyrvgdmtqaliweqyslpvapetlragqgydmilepnaaealeppq
sprddvwvnktgstqgfggyivmlpgkhtglvmlanknypndarveaayrilsglga

SCOPe Domain Coordinates for d3ws0b_:

Click to download the PDB-style file with coordinates for d3ws0b_.
(The format of our PDB-style files is described here.)

Timeline for d3ws0b_: