SCOPe 2.05: Domain d3wrtb_: 3wrt B:

Lineage for d3wrtb_ (3wrt B:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Chromohalobacter sp. [TaxId:169132] [270012] (7 PDB entries)

8. Domain d3wrtb_: 3wrt B: [270029]
   automated match to d1s6ra_

Details for d3wrtb_

PDB Entry: 3wrt, 2.9 Å

PDB Description: wild type beta-lactamase derived from chromohalobacter sp.560

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3wrtb_:

Sequence; same for both SEQRES and ATOM records:

>d3wrtb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Chromohalobacter sp. [TaxId: 169132]}
qtrevldpivaslmeaqqipgmaialvrpegttishygaadretgtpvdddtlfeigsls
ktltatlaslaevegkldfdapvsrylpelegsafddisglnlgthtggglplfvpdevt
draslmawyrewqptepigesrtysnlgigllgletaasldgefvptmrakvlaplgmqd
twydvpearmadyamgedkdgqptrvspgvlddeaygikttaadlaklvranlhladvda
elqqaidatrqghyrvgdmtqaliweqyslpvapetlragngydmilepnaaealeppqs
prddvwvnktgstngfggyivmlpgkhtglvmlanknypndarveaayrilsglga

Timeline for d3wrtb_:

• d3wrtb_ is new in SCOPe 2.05-stable
  
• d3wrtb_ appears in SCOPe 2.06
  
• d3wrtb_ appears in the current release, SCOPe 2.08