![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
![]() | Protein AMPC beta-Lactamase, class C [56618] (4 species) contains small alpha+beta subdomain inserted in the common fold |
![]() | Species Chromohalobacter sp. [TaxId:169132] [270012] (7 PDB entries) |
![]() | Domain d3ws4b_: 3ws4 B: [270028] automated match to d1s6ra_ complexed with cl, sr; mutant |
PDB Entry: 3ws4 (more details), 1.9 Å
SCOPe Domain Sequences for d3ws4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ws4b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Chromohalobacter sp. [TaxId: 169132]} qtrevldpivaslmeaqqipgmaialvrpegttishygaadretgtpvdddtlfeigsls ktltatlaslaevegkldfdapvsrylpelegsafddisglnlgthtggglplfvpdevt draslmawyrewqptepigesrtysnlgigllgletaasldgefvptmrakvlaplgmqd twydvpearmadyamgedkdgqptrvspgvlddeaygikttaadlaklvranlhladvda elqqaidatrqghyrvgdmtqaliweqyslpvapetlragqgydmilepnaaealeppqs prddvwvnktgstqgfggyivmlpgkhtglvmlanknypndarveaayrilsglgaidv
Timeline for d3ws4b_: