SCOPe 2.08: Domain d4w89a_: 4w89 A:

Lineage for d4w89a_ (4w89 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [188624] (13 PDB entries)

8. Domain d4w89a_: 4w89 A: [269977]
   automated match to d4im4a_
   complexed with mg

Details for d4w89a_

PDB Entry: 4w89, 2.4 Å

PDB Description: crystal structure of xeg5a, a gh5 xyloglucan-specific endo-beta-1,4- glucanase from metagenomic library, in complex with cellotriose

PDB Compounds: (A:) Xyloglucan-specific endo-beta-1,4-glucanase

SCOPe Domain Sequences for d4w89a_:

Sequence; same for both SEQRES and ATOM records:

>d4w89a_ c.1.8.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
drsrvfdilsninigwnlgntldatgggnsvnaetswgnpkttqeivdtvndrgfnairi
pvtfanhlgpapeytisadwlarvkevvdyavndgmyiildthhetnywlktdpnneaal
ceelaaiwkqlaeafkdydeklmfegmneprmagsakewsggtpaerklinamnkafida
vratggnnadrvliictyghnsdeptlkdleipsdpniavalhtytpyfftyvadgsysv
wngskknditwqynnikkylidkgipvvitetgaqfkentedivrwigdyvgtldqdgvk
cfiwdnniyhgngekfgllnrsllkwynddivdayvnha

Timeline for d4w89a_:

• d4w89a_ first appeared in SCOPe 2.05
  
• d4w89a_ appears in SCOPe 2.07