Lineage for d4w86b_ (4w86 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2096032Species Uncultured bacterium [TaxId:77133] [188624] (10 PDB entries)
  8. 2096049Domain d4w86b_: 4w86 B: [269975]
    automated match to d4im4a_
    complexed with bgc, mg, trs

Details for d4w86b_

PDB Entry: 4w86 (more details), 2.64 Å

PDB Description: crystal structure of xeg5a, a gh5 xyloglucan-specific endo-beta-1,4- glucanase from ruminal metagenomic library, in complex with glucose and tris
PDB Compounds: (B:) Xyloglucan-specific endo-beta-1,4-glucanase

SCOPe Domain Sequences for d4w86b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w86b_ c.1.8.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
drsrvfdilsninigwnlgntldatgggnsvnaetswgnpkttqeivdtvndrgfnairi
pvtfanhlgpapeytisadwlarvkevvdyavndgmyiildthhetnywlktdpnneaal
ceelaaiwkqlaeafkdydeklmfegmneprmagsakewsggtpaerklinamnkafida
vratggnnadrvliictyghnsdeptlkdleipsdpniavalhtytpyfftyvadgsysv
wngskknditwqynnikkylidkgipvvitetgaqfkentedivrwigdyvgtldqdgvk
cfiwdnniyhgngekfgllnrsllkwynddivdayvnha

SCOPe Domain Coordinates for d4w86b_:

Click to download the PDB-style file with coordinates for d4w86b_.
(The format of our PDB-style files is described here.)

Timeline for d4w86b_: