Lineage for d4w8ne_ (4w8n E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778858Species Influenza a virus [TaxId:489926] [269970] (1 PDB entry)
  8. 1778861Domain d4w8ne_: 4w8n E: [269974]
    Other proteins in same PDB: d4w8nb_, d4w8nd_, d4w8nf_
    automated match to d4fiua1
    complexed with nag, ndg

Details for d4w8ne_

PDB Entry: 4w8n (more details), 2.9 Å

PDB Description: the crystal structure of hemagglutinin from a swine influenza virus (a/swine/missouri/2124514/2006)
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4w8ne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w8ne_ b.19.1.0 (E:) automated matches {Influenza a virus [TaxId: 489926]}
qicigyhannstekvdtilernvtvthaknilekthngklcrlsgipplelgdcsiagwl
lgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlltsvthfekvkilprdq
wtqhtttggsracavsgnpsffrnmvwltkkgsnypiakrsynntsgeqmlviwgihhpn
ddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvnglggrmefswtlletwdvinfe
stgnliapeygfkiskrgssgimktekilencetkcqtplgainttlpfhnihpltigec
pkyvksdrlilatglrnvp

SCOPe Domain Coordinates for d4w8ne_:

Click to download the PDB-style file with coordinates for d4w8ne_.
(The format of our PDB-style files is described here.)

Timeline for d4w8ne_: