SCOPe 2.06: Domain d4w88b1: 4w88 B:92-430

Lineage for d4w88b1 (4w88 B:92-430)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [188624] (10 PDB entries)

8. Domain d4w88b1: 4w88 B:92-430 [269969]
   Other proteins in same PDB: d4w88b2
   automated match to d4im4a_
   complexed with bgc, gal, mg, trs, xys

Details for d4w88b1

PDB Entry: 4w88, 1.58 Å

PDB Description: crystal structure of xeg5a, a gh5 xyloglucan-specific endo-beta-1,4- glucanase from ruminal metagenomic library, in complex with a xyloglucan oligosaccharide and tris

PDB Compounds: (B:) Xyloglucan-specific endo-beta-1,4-glucanase

SCOPe Domain Sequences for d4w88b1:

Sequence; same for both SEQRES and ATOM records:

>d4w88b1 c.1.8.0 (B:92-430) automated matches {Uncultured bacterium [TaxId: 77133]}
drsrvfdilsninigwnlgntldatgggnsvnaetswgnpkttqeivdtvndrgfnairi
pvtfanhlgpapeytisadwlarvkevvdyavndgmyiildthhetnywlktdpnneaal
ceelaaiwkqlaeafkdydeklmfegmneprmagsakewsggtpaerklinamnkafida
vratggnnadrvliictyghnsdeptlkdleipsdpniavalhtytpyfftyvadgsysv
wngskknditwqynnikkylidkgipvvitetgaqfkentedivrwigdyvgtldqdgvk
cfiwdnniyhgngekfgllnrsllkwynddivdayvnha

Timeline for d4w88b1:

• d4w88b1 first appeared in SCOPe 2.05, called d4w88b_
  
• d4w88b1 appears in SCOPe 2.07
  
• d4w88b1 appears in the current release, SCOPe 2.08