Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (72 species) not a true protein |
Species Uncultured bacterium [TaxId:77133] [188624] (9 PDB entries) |
Domain d4w87b_: 4w87 B: [269967] automated match to d4im4a_ complexed with bgc, mg, xys |
PDB Entry: 4w87 (more details), 2.15 Å
SCOPe Domain Sequences for d4w87b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w87b_ c.1.8.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]} drsrvfdilsninigwnlgntldatgggnsvnaetswgnpkttqeivdtvndrgfnairi pvtfanhlgpapeytisadwlarvkevvdyavndgmyiildthhetnywlktdpnneaal ceelaaiwkqlaeafkdydeklmfegmneprmagsakewsggtpaerklinamnkafida vratggnnadrvliictyghnsdeptlkdleipsdpniavalhtytpyfftyvadgsysv wngskknditwqynnikkylidkgipvvitetgaqfkentedivrwigdyvgtldqdgvk cfiwdnniyhgngekfgllnrsllkwynddivdayvnha
Timeline for d4w87b_: