SCOPe 2.05: Domain d4w87b_: 4w87 B:

Lineage for d4w87b_ (4w87 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [188624] (9 PDB entries)

8. Domain d4w87b_: 4w87 B: [269967]
   automated match to d4im4a_
   complexed with bgc, mg, xys

Details for d4w87b_

PDB Entry: 4w87, 2.15 Å

PDB Description: crystal structure of xeg5a, a gh5 xyloglucan-specific endo-beta-1,4- glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide

PDB Compounds: (B:) Xyloglucan-specific endo-beta-1,4-glucanase

SCOPe Domain Sequences for d4w87b_:

Sequence; same for both SEQRES and ATOM records:

>d4w87b_ c.1.8.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
drsrvfdilsninigwnlgntldatgggnsvnaetswgnpkttqeivdtvndrgfnairi
pvtfanhlgpapeytisadwlarvkevvdyavndgmyiildthhetnywlktdpnneaal
ceelaaiwkqlaeafkdydeklmfegmneprmagsakewsggtpaerklinamnkafida
vratggnnadrvliictyghnsdeptlkdleipsdpniavalhtytpyfftyvadgsysv
wngskknditwqynnikkylidkgipvvitetgaqfkentedivrwigdyvgtldqdgvk
cfiwdnniyhgngekfgllnrsllkwynddivdayvnha

Timeline for d4w87b_:

• d4w87b_ is new in SCOPe 2.05-stable
  
• d4w87b_ appears in SCOPe 2.06
  
• d4w87b_ appears in the current release, SCOPe 2.08