Lineage for d4w7oa_ (4w7o A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193227Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2193599Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2193600Protein automated matches [190081] (27 species)
    not a true protein
  7. 2193609Species Auricularia auricula-judae [TaxId:29892] [193309] (12 PDB entries)
  8. 2193617Domain d4w7oa_: 4w7o A: [269962]
    automated match to d4au9a_
    complexed with hem; mutant

Details for d4w7oa_

PDB Entry: 4w7o (more details), 1.2 Å

PDB Description: crystal structure of a decolorizing peroxidase (dyp) from auricularia auricula-judae. g169l, y147s and w377s triple mutant
PDB Compounds: (A:) dye-decolorizing peroxidase

SCOPe Domain Sequences for d4w7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w7oa_ d.58.4.0 (A:) automated matches {Auricularia auricula-judae [TaxId: 29892]}
slntidiqgdilvgmhkqkqlfyffaindpatfkthlasdiapvvasvtqlsnvatqplv
alniafsntgllalgvtdnlgdslfangqakdatsfkestsswvpqfagtgihgviilas
dttdlidqqvasiestfgssisklsslsasirpgneaghemfgfldliaqpaingfntpl
pgqnivdagviitgatndpitrpswavggsflafrqleqlvpefnkylldnapagsgslq
aradllgarmvgrwksgapidltptaddpalgadaqrnnnftyshagfdlgsdqshcpfs
ahirktrpradlggsltppnlsagansimrsgipygpevtsaesasntttqerglafvay
qaqlsqgfhflqqtsadnanfppgktpatvgldpiigqnngqprvvngllpsnssaslsi
pqfvvshggeyffsppisaiggrlsa

SCOPe Domain Coordinates for d4w7oa_:

Click to download the PDB-style file with coordinates for d4w7oa_.
(The format of our PDB-style files is described here.)

Timeline for d4w7oa_: