Lineage for d1rrpd_ (1rrp D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113158Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 113159Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 113238Family b.55.1.3: Ran-binding domain [50764] (2 proteins)
  6. 113239Protein Nuclear pore complex protein Nup358 [50765] (1 species)
  7. 113240Species Human (Homo sapiens) [TaxId:9606] [50766] (1 PDB entry)
  8. 113242Domain d1rrpd_: 1rrp D: [26996]
    Other proteins in same PDB: d1rrpa_, d1rrpc_

Details for d1rrpd_

PDB Entry: 1rrp (more details), 2.96 Å

PDB Description: structure of the ran-gppnhp-ranbd1 complex

SCOP Domain Sequences for d1rrpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrpd_ b.55.1.3 (D:) Nuclear pore complex protein Nup358 {Human (Homo sapiens)}
hfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsgki
rllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktpee
aalfkckfeeaqsi

SCOP Domain Coordinates for d1rrpd_:

Click to download the PDB-style file with coordinates for d1rrpd_.
(The format of our PDB-style files is described here.)

Timeline for d1rrpd_: