Lineage for d1rrpd_ (1rrp D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394741Family b.55.1.3: Ran-binding domain [50764] (5 proteins)
  6. 2394742Protein Nuclear pore complex protein Nup358 [50765] (1 species)
  7. 2394743Species Human (Homo sapiens) [TaxId:9606] [50766] (1 PDB entry)
  8. 2394745Domain d1rrpd_: 1rrp D: [26996]
    Other proteins in same PDB: d1rrpa_, d1rrpc_
    complexed with gnp, mg

Details for d1rrpd_

PDB Entry: 1rrp (more details), 2.96 Å

PDB Description: structure of the ran-gppnhp-ranbd1 complex
PDB Compounds: (D:) nuclear pore complex protein nup358

SCOPe Domain Sequences for d1rrpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrpd_ b.55.1.3 (D:) Nuclear pore complex protein Nup358 {Human (Homo sapiens) [TaxId: 9606]}
hfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsgki
rllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktpee
aalfkckfeeaqsi

SCOPe Domain Coordinates for d1rrpd_:

Click to download the PDB-style file with coordinates for d1rrpd_.
(The format of our PDB-style files is described here.)

Timeline for d1rrpd_: