Lineage for d1rrpb_ (1rrp B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61845Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 61846Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 61925Family b.55.1.3: Ran-binding domain of nuclear pore complex protein Nup358 [50764] (1 protein)
  6. 61926Protein Ran-binding domain of nuclear pore complex protein Nup358 [50765] (1 species)
  7. 61927Species Human (Homo sapiens) [TaxId:9606] [50766] (1 PDB entry)
  8. 61928Domain d1rrpb_: 1rrp B: [26995]
    Other proteins in same PDB: d1rrpa_, d1rrpc_

Details for d1rrpb_

PDB Entry: 1rrp (more details), 2.96 Å

PDB Description: structure of the ran-gppnhp-ranbd1 complex

SCOP Domain Sequences for d1rrpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrpb_ b.55.1.3 (B:) Ran-binding domain of nuclear pore complex protein Nup358 {Human (Homo sapiens)}
hfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsgki
rllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktpee
aalfkckfeeaqsi

SCOP Domain Coordinates for d1rrpb_:

Click to download the PDB-style file with coordinates for d1rrpb_.
(The format of our PDB-style files is described here.)

Timeline for d1rrpb_: